PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G34390.1
Common NameARF22, F7P12.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARF
Protein Properties Length: 598aa    MW: 67733.2 Da    PI: 6.0536
Description auxin response factor 22
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G34390.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B367.32.2e-21126225199
                  EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                  f kvlt sd++  g + +pkk+a e+     ++++  +++l  +d++g++W+++++yr++++r++lt+GW+ F  +++L +gD++vF   + +++el+
  AT1G34390.1 126 FTKVLTASDTS--GGFFVPKKHAIEClppldMSQPLPTQELLATDLHGNQWRFNHNYRGTPQRHLLTTGWNAFTTSKKLVAGDVIVFV--RGETGELR 219
                  78999776665..45899************9666667789************************************************..449999** PP

                  EEEE-S CS
           B3  94 vkvfrk 99 
                  v+++r+
  AT1G34390.1 220 VGIRRA 225
                  ***996 PP

2Auxin_resp981.4e-32250329183
   Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                  a ha++++++F vvY+Pr+  s+F+v+++k+++a+++k+ vG+Rf m+fe++d+serr+ Gt++gvsd++p +W+ S+Wr+L+
  AT1G34390.1 250 AKHAFDNQCMFIVVYKPRS--SQFIVSYDKFLDAVNNKFNVGSRFTMRFEGDDFSERRYFGTIIGVSDFSP-HWKCSEWRNLE 329
                  6899**************6..9*************************************************.********995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.2E-35116237IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.88E-28123246IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.519124226IPR003340B3 DNA binding domain
CDDcd100177.07E-20125224No hitNo description
PfamPF023621.1E-18126225IPR003340B3 DNA binding domain
SMARTSM010193.7E-20126226IPR003340B3 DNA binding domain
PfamPF065073.0E-28250328IPR010525Auxin response factor
PfamPF023091.2E-5502545IPR033389AUX/IAA domain
SuperFamilySSF542771.08E-10506585No hitNo description
PROSITE profilePS5174524.746509590IPR000270PB1 domain
PfamPF023091.1E-5552590IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 598 aa     Download sequence    Send to blast
MESGNIVNAQ PELSGIIDGS KSYMYEQLWK LCAGPLCDIP KLGEKIYYFP QGNIELVEAS  60
TREELNELKP ICDLPSKLQC RVIAIQLKVE NNSDETYAEI TLMPDTTQVV IPTQNENQFR  120
PLVNSFTKVL TASDTSGGFF VPKKHAIECL PPLDMSQPLP TQELLATDLH GNQWRFNHNY  180
RGTPQRHLLT TGWNAFTTSK KLVAGDVIVF VRGETGELRV GIRRAGHQQG NIPSSIISIE  240
SMRHGVIASA KHAFDNQCMF IVVYKPRSSQ FIVSYDKFLD AVNNKFNVGS RFTMRFEGDD  300
FSERRYFGTI IGVSDFSPHW KCSEWRNLEV QWDEFASFSR PNKVSPWEIE HLMPALNVPR  360
PSLLKNKRLR EVNEIGSSSS HLLPPILTQG QEIGQLSVAS PMNISLTYRD TTEDVMNPSR  420
LLMSYPVQPM PKLNYNNQMV TQIEENITTK TGTNFRLFGV SLVTPSVIKD PIEEIGSEIS  480
KLTEGKKFGQ SQTLRSPTEI QSKQFSSTRT CTKVQMQGVT IERAVDLSVL NGYDQLILEL  540
EELFDLKGQL QTRNQWEIAF TDSDDDKMLV GDDPWPEFCN MVKKILIFKR GGQKLEVQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-11913521355Auxin response factor 1
4ldw_A1e-11913521355Auxin response factor 1
4ldw_B1e-11913521355Auxin response factor 1
4ldx_A1e-11913521355Auxin response factor 1
4ldx_B1e-11913521355Auxin response factor 1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO793566720.0
Genevisible261163_x_at0.0
Expression AtlasAT1G34390-
AtGenExpressAT1G34390-
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G34390.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9C8N7
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G34390
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6697960.0AY669796.1 Arabidopsis thaliana clone C105354 ARF22 (At1g34390) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_174699.20.0auxin response factor 22
SwissprotQ9C8N70.0ARFV_ARATH; Auxin response factor 22
TrEMBLC0SUZ10.0C0SUZ1_ARATH; Auxin response factor (Fragment)
STRINGAT1G34390.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Representative plantOGRP5261578
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Hagen G,Guilfoyle T
    Auxin-responsive gene expression: genes, promoters and regulatory factors.
    Plant Mol. Biol., 2002 Jun-Jul. 49(3-4): p. 373-85
    [PMID:12036261]
  3. Remington DL,Vision TJ,Guilfoyle TJ,Reed JW
    Contrasting modes of diversification in the Aux/IAA and ARF gene families.
    Plant Physiol., 2004. 135(3): p. 1738-52
    [PMID:15247399]
  4. Okushima Y, et al.
    Functional genomic analysis of the AUXIN RESPONSE FACTOR gene family members in Arabidopsis thaliana: unique and overlapping functions of ARF7 and ARF19.
    Plant Cell, 2005. 17(2): p. 444-63
    [PMID:15659631]
  5. Axtell MJ,Snyder JA,Bartel DP
    Common functions for diverse small RNAs of land plants.
    Plant Cell, 2007. 19(6): p. 1750-69
    [PMID:17601824]
  6. Swaminathan K,Peterson K,Jack T
    The plant B3 superfamily.
    Trends Plant Sci., 2008. 13(12): p. 647-55
    [PMID:18986826]
  7. Ikeda M,Ohme-Takagi M
    A novel group of transcriptional repressors in Arabidopsis.
    Plant Cell Physiol., 2009. 50(5): p. 970-5
    [PMID:19324928]
  8. Varaud E, et al.
    AUXIN RESPONSE FACTOR8 regulates Arabidopsis petal growth by interacting with the bHLH transcription factor BIGPETALp.
    Plant Cell, 2011. 23(3): p. 973-83
    [PMID:21421811]
  9. Vernoux T, et al.
    The auxin signalling network translates dynamic input into robust patterning at the shoot apex.
    Mol. Syst. Biol., 2011. 7: p. 508
    [PMID:21734647]
  10. Wang J,Yan DW,Yuan TT,Gao X,Lu YT
    A gain-of-function mutation in IAA8 alters Arabidopsis floral organ development by change of jasmonic acid level.
    Plant Mol. Biol., 2013. 82(1-2): p. 71-83
    [PMID:23483289]
  11. Piya S,Shrestha SK,Binder B,Stewart CN,Hewezi T
    Protein-protein interaction and gene co-expression maps of ARFs and Aux/IAAs in Arabidopsis.
    Front Plant Sci, 2014. 5: p. 744
    [PMID:25566309]